PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2810_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 72aa    MW: 8211.18 Da    PI: 9.6589
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2810_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-182063145
                                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                                        rg W + Ede+l ++v q+G+ +W++Ia++++ gR++k+c++rw+
  cra_locus_2810_iso_2_len_879_ver_3 20 RGHWRPAEDEKLRQLVDQYGPQNWNSIAEKLQ-GRSGKSCRLRWY 63
                                        899*****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.3521568IPR017930Myb domain
SuperFamilySSF466894.09E-151864IPR009057Homeodomain-like
SMARTSM007176.1E-131968IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-192063IPR009057Homeodomain-like
PfamPF002491.2E-172063IPR001005SANT/Myb domain
CDDcd001675.39E-142363No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MAAAAASDHI HDDDARTCPR GHWRPAEDEK LRQLVDQYGP QNWNSIAEKL QGRSGKSCRL  60
RWYYGKKAKG TI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101908.13e-29PREDICTED: transcription factor MYB113
SwissprotQ9FDW16e-15MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059PRX55e-30A0A059PRX5_SALMI; MYB-related transcription factor
TrEMBLA0A068UTV61e-30A0A068UTV6_COFCA; Uncharacterized protein
STRINGGLYMA06G12691.16e-27(Glycine max)